PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016475060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 292aa    MW: 31986.1 Da    PI: 9.4581
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016475060.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-1488132347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
   XP_016475060.1  88 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 132
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.99781137IPR017930Myb domain
SuperFamilySSF466894.41E-1783138IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-1784135IPR006447Myb domain, plants
SMARTSM007171.8E-1085135IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-1187132IPR009057Homeodomain-like
CDDcd001671.56E-988133No hitNo description
PfamPF002491.7E-1188132IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MSSACCDESS AEVVAGGGVG GEIMLFGVRV KVDPMRKSVS LNNLSQYEQP NANNSADTSK  60
VAEEGYASAD DAVQHHSNSG RERKRGVPWT EEEHKLFLLG LQKVGKGDWR GISRNFVKTR  120
TPTQVASHAQ KYFLRRSNLN RRRRRSSLFD ITTDSVSAMP IEEGKNKQEI PVPPVVASSP  180
TLPTTIEATK TNAFPVAPIM LPAQIDQSRE SPTLLQRNQV NSYTPVRPLP MLSMPNPSTV  240
FDLNVNQISE VEPLSLRLSL SLDQGQASST RHHSAFKVMP SFSNGESIIS VA
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00149DAPTransfer from AT1G19000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1600956e-78AC160095.1 Solanum lycopersicum clone BB, complete sequence.
GenBankAC2095116e-78AC209511.1 Solanum lycopersicum chromosome 6 clone C06HBa0153G23, complete sequence.
GenBankAY7961146e-78AY796114.1 Lycopersicon esculentum clone Le_HBa 153G23 putative transposase, putative BAH domain-containing protein, putative permease I, putative pollen specific LIM domain-containing protein, putative betaine aldehyde dehyrogenase, EDS1, and putative ribosomal-protein S6 kinase-like protein genes, complete cds.
GenBankHG9754456e-78HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755186e-78HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016475060.10.0PREDICTED: transcription factor MYB1R1-like
SwissprotQ2V9B01e-127MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLM1D6D21e-125M1D6D2_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000830321e-125(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA25742351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19000.28e-63MYB_related family protein